HPA008411

EAF2 antibody from Sigma-Aldrich
BM040, TRAITS, U19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008411
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008411, RRID:AB_1847950
Product name
Anti-EAF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008411
Antibody type
Polyclonal
Antigen
ELL-associated factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKP
ASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTV
FKGSKKPYLKECILIINHDTGECRL
Storage
-20C
Provider Type Product Number
- No reagents -