Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00065061-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00065061-A01, RRID:AB_463518
- Product name
- ALS2CR7 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ALS2CR7.
- Antigen sequence
MFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWPG
VSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAED
LASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQL
P- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ALS2CR7 expression in transfected 293T cell line by ALS2CR7 polyclonal antibody (A01).Lane1:ALS2CR7 transfected lysate(43.574 KDa).Lane2:Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALS2CR7 polyclonal antibody (A01), Lot # CRU5060602QCS1. Western Blot analysis of ALS2CR7 expression in U-2 OS.