HPA015786

CDK15 antibody from Sigma-Aldrich
ALS2CR7, PFTAIRE2, PFTK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015786
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015786, RRID:AB_1844780
Product name
Anti-ALS2CR7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015786
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PFTAIRE-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSA
QEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKP
EMCDLLASYQKGHHPA
Storage
-20C
Provider Type Product Number
- No reagents -