HPA015786

CDK15 antibody from Atlas Antibodies
ALS2CR7, PFTAIRE2, PFTK2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015786
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015786, RRID:AB_1844780
Product name
Anti-CDK15
Provider product page
Atlas Antibodies - HPA015786
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSA
QEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKP
EMCDLLASYQKGHHPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -