Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001810-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001810-B01, RRID:AB_1113567
- Product name
- DR1 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human DR1 protein.
- Antigen sequence
MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDA
RELVVNCCTEFIHLISSEANEICNKSEKKTISPEH
VIQALESLGFGSYISEVKEVLQECKTVALKRRKAS
SRLENLGIPEEELLRQQQELFAKARQQQAELAQQE
WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDD
I- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DR1 expression in transfected 293T cell line (H00001810-T01) by DR1 MaxPab polyclonal antibody.Lane 1: DR1 transfected lysate(19.36 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DR1 MaxPab polyclonal antibody. Western Blot analysis of DR1 expression in Hela S3 NE.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DR1 MaxPab polyclonal antibody. Western Blot analysis of DR1 expression in Jurkat.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DR1 MaxPab polyclonal antibody. Western Blot analysis of DR1 expression in Raw 264.7.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to DR1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol