HPA018472

NOP58 antibody from Sigma-Aldrich
HSPC120, NOP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018472
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018472, RRID:AB_1854564
Product name
Anti-NOP58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018472
Antibody type
Polyclonal
Antigen
Nucleolar protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETP
EKANKIVKLKHFEKFQDTAEALAAFTALMEGKINK
QLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLS
CIHSPVVNELMRGIRSQMDGL
Storage
-20C
Provider Type Product Number
- No reagents -