HPA018472

NOP58 antibody from Atlas Antibodies
HSPC120, NOP5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018472
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018472, RRID:AB_1236252
Product name
Anti-NOP58
Provider product page
Atlas Antibodies - HPA018472
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETP
EKANKIVKLKHFEKFQDTAEALAAFTALMEGKINK
QLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLS
CIHSPVVNELMRGIRSQMDGL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -