HPA026534

ARHGAP29 antibody from Atlas Antibodies
PARG1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026534
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026534, RRID:AB_1844998
Product name
Anti-ARHGAP29
Provider product page
Atlas Antibodies - HPA026534
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTTAPITISSLAEYSNQARLVEFLITYSQKIFDGS
LQPQDVMCSIGVVDQGCFPKPLLSPEERDIERSMK
SLFFSSKEDIHTSESESKIFERATSFEESERKQNA
LGK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -