Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184112 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-WD Repeat Domain 12 (WDR12) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WDR12 antibody: synthetic peptide directed towards the C terminal of human WDR12
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGA
DNKLY SYRYSPTTSH- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mammalian WDR12 is a novel member of the Pes1-Bop1 complex and is required for ribosome biogenesis and cell proliferation.
Hölzel M, Rohrmoser M, Schlee M, Grimm T, Harasim T, Malamoussi A, Gruber-Eber A, Kremmer E, Hiddemann W, Bornkamm GW, Eick D
The Journal of cell biology 2005 Aug 1;170(3):367-78
The Journal of cell biology 2005 Aug 1;170(3):367-78
No comments: Submit comment
No validations: Submit validation data