HPA012296

SLA antibody from Sigma-Aldrich
hSLAP, SLA1, SLAP, SLAP-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012296
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012296, RRID:AB_1856946
Product name
Anti-SLA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012296
Antibody type
Polyclonal
Antigen
SRC-like-adapter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPS
PDISPPIFRRGEKLRVISDEGGWWKAISLSTGRES
YIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKV
GSFMIRESETKKGFYS
Storage
-20C
Provider Type Product Number
- No reagents -