HPA012296

SLA antibody from Atlas Antibodies
hSLAP, SLA1, SLAP, SLAP-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012296
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012296, RRID:AB_1856946
Product name
Anti-SLA
Provider product page
Atlas Antibodies - HPA012296
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPS
PDISPPIFRRGEKLRVISDEGGWWKAISLSTGRES
YIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKV
GSFMIRESETKKGFYS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -