HPA016744

RAPH1 antibody from Sigma-Aldrich
ALS2CR18, ALS2CR9, KIAA1681
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016744
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016744, RRID:AB_1844781
Product name
Anti-RAPH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016744
Antibody type
Polyclonal
Antigen
Ras-associated and pleckstrin homology domains-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDK
LTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIY
NLN
Storage
-20C
Provider Type Product Number
- No reagents -