HPA016744

RAPH1 antibody from Atlas Antibodies
ALS2CR18, ALS2CR9, KIAA1681
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016744
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016744, RRID:AB_1844781
Product name
Anti-RAPH1
Provider product page
Atlas Antibodies - HPA016744
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDK
LTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIY
NLN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -