PAB20385

HECW1 antibody from Abnova Corporation
KIAA0322, NEDL1

Antibody data

Product number
PAB20385
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20385, RRID:AB_10964012
Product name
HECW1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20385
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant HECW1.
Antigen sequence
EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRP
CSLPVSELETVIASACGDPETPRTHYIRIHTLLHS
MPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVD
TVAADPSALE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -