PAB20386

HECW1 antibody from Abnova Corporation
KIAA0322, NEDL1

Antibody data

Product number
PAB20386
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20386, RRID:AB_10966218
Product name
HECW1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20386
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant HECW1.
Antigen sequence
STEPESAQIQDSPMNNLMESGSGEPRSEAPESSES
WKPEQLGEGSVPDGPGNQSIELSRPAEEAAVITEA
GDQGMVSVGPEGAGELLAQVQKDIQPAPSAEELAE
QLDLGEEASALLLEDGEAPAS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -