HPA007609

HECW1 antibody from Sigma-Aldrich
KIAA0322, NEDL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007609
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007609, RRID:AB_2117518
Product name
Anti-HECW1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007609
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase HECW1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STEPESAQIQDSPMNNLMESGSGEPRSEAPESSES
WKPEQLGEGSVPDGPGNQSIELSRPAEEAAVITEA
GDQGMVSVGPEGAGELLAQVQKDIQPAPSAEELAE
QLDLGEEASALLLEDGEAPAS
Storage
-20C
Provider Type Product Number
- No reagents -