Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405675 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PAP2D antibody: synthetic peptide directed towards the N terminal of human PAP2D
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYS
LAAGV PVLVIIVGET- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cloning and characterization of a novel human phosphatidic acid phosphatase type 2, PAP2d, with two different transcripts PAP2d_v1 and PAP2d_v2.
Sun L, Gu S, Sun Y, Zheng D, Wu Q, Li X, Dai J, Dai J, Ji C, Xie Y, Mao Y
Molecular and cellular biochemistry 2005 Apr;272(1-2):91-6
Molecular and cellular biochemistry 2005 Apr;272(1-2):91-6
No comments: Submit comment
No validations: Submit validation data