HPA018072

PLPPR5 antibody from Sigma-Aldrich
LPPR5, PAP2, PAP2D, PRG5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018072
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018072, RRID:AB_1854958
Product name
Anti-PPAPR5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018072
Antibody type
Polyclonal
Antigen
Lipid phosphate phosphatase-related protein type 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITA
FAEVT
Storage
-20C
Provider Type Product Number
- No reagents -