HPA007610

KDM4A antibody from Sigma-Aldrich
JHDM3A, JMJD2, JMJD2A, KIAA0677, TDRD14A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007610
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007610, RRID:AB_1852006
Product name
Anti-JMJD2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007610
Antibody type
Polyclonal
Antigen
JmjC domain-containing histone demethylation protein 3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
FLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKT
SLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSS
EQYEMTEC
Storage
-20C
Provider Type Product Number
- No reagents -