Antibody data

Product number
PAB20970
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20970, RRID:AB_10964984
Product name
FRRS1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20970
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FRRS1.
Antigen sequence
SHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVF
LSFTRDDQSVMVEMSGPSKGYLSFALSHDQWMGDD
DAYLCIHEDQTVYIQPSHLTGRSHPVMDSRDTLED
MAWRLADGVMQCSFRRNITLPGVKNRFDLNTSYYI
FLADGAANDG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -