HPA017883

FRRS1 antibody from Sigma-Aldrich
SDFR2, SDR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017883
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017883, RRID:AB_2294223
Product name
Anti-FRRS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017883
Antibody type
Polyclonal
Antigen
Ferric-chelate reductase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVF
LSFTRDDQSVMVEMSGPSKGYLSFALSHDQWMGDD
DAYLCIHEDQTVYIQPSHLTGRSHPVMDSRDTLED
MAWRLADGVMQCSFRRNITLPGVKNRFDLNTSYYI
FLADGAANDG
Storage
-20C
Provider Type Product Number
- No reagents -