Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310521 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC35A3 antibody: synthetic peptide directed towards the middle region of human SLC35A3
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFS
SGFAG VYFEKILKET- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Evaluation of SLC35A3 as a candidate gene for human vertebral malformations.
Ghebranious N, Burmester JK, Glurich I, McPherson E, Ivacic L, Kislow J, Rasmussen K, Kumar V, Raggio CL, Blank RD, Jacobsen FS, Faciszewski T, Womack J, Giampietro PF
American journal of medical genetics. Part A 2006 Jun 15;140(12):1346-8
American journal of medical genetics. Part A 2006 Jun 15;140(12):1346-8
No comments: Submit comment
No validations: Submit validation data