PAB20651

P3H2 antibody from Abnova Corporation
FLJ10718, LEPREL1, MLAT4

Antibody data

Product number
PAB20651
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20651, RRID:AB_10963804
Product name
LEPREL1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20651
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LEPREL1.
Antigen sequence
ANPEHMEMQQNIENYRATAGVEALQLVDREAKPHM
ESYNAGVKHYEADDFEMAIRHFEQALREYFVEDTE
CRTLCEGPQRFEEYEYLGYKAGLYEAIADHYMQVL
VCQHECV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -