HPA007890

P3H2 antibody from Sigma-Aldrich
FLJ10718, LEPREL1, MLAT4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007890
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007890, RRID:AB_1852796
Product name
Anti-LEPREL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007890
Antibody type
Polyclonal
Antigen
Prolyl 3-hydroxylase 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHYDYLQFAYYRVGEYVKALECAKAYLLCHPDDED
VLDNVDYYESLLDDSIDPASIEAREDLTMFVKRHK
LESELIKSAAEGLGFSYTEPNYWIRYGGRQDENRV
PSGVNVEGAEVHGFSMGKKLSPKIDRDLREGGPLL
Y
Storage
-20C
Provider Type Product Number
- No reagents -