HPA013355

P3H2 antibody from Sigma-Aldrich
FLJ10718, LEPREL1, MLAT4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013355
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013355, RRID:AB_1852798
Product name
Anti-LEPREL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013355
Antibody type
Polyclonal
Antigen
Prolyl 3-hydroxylase 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANPEHMEMQQNIENYRATAGVEALQLVDREAKPHM
ESYNAGVKHYEADDFEMAIRHFEQALREYFVEDTE
CRTLCEGPQRFEEYEYLGYKAGLYEAIADHYMQVL
VCQHECV
Storage
-20C
Provider Type Product Number
- No reagents -