H00057492-M01
antibody from Abnova Corporation
Targeting: ARID1B
6A3-5, BAF250b, DAN15, ELD/OSA1, KIAA1235, p250R
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057492-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057492-M01, RRID:AB_605947
- Product name
- ARID1B monoclonal antibody (M01), clone 2D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARID1B.
- Antigen sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDR
RPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGP
LQSSSSEGPQQNMWAARNDMPYPYQNR- Isotype
- IgG
- Antibody clone number
- 2D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Frequent loss of the expression of multiple subunits of the SWI/SNF complex in large cell carcinoma and pleomorphic carcinoma of the lung.
Loss of ARID1A, ARID1B, and ARID2 Expression During Progression of Gastric Cancer.
Yoshimoto T, Matsubara D, Nakano T, Tamura T, Endo S, Sugiyama Y, Niki T
Pathology international 2015 Nov;65(11):595-602
Pathology international 2015 Nov;65(11):595-602
Loss of ARID1A, ARID1B, and ARID2 Expression During Progression of Gastric Cancer.
Aso T, Uozaki H, Morita S, Kumagai A, Watanabe M
Anticancer research 2015 Dec;35(12):6819-27
Anticancer research 2015 Dec;35(12):6819-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ARID1B monoclonal antibody (M01), clone 2D2 Western Blot analysis of ARID1B expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ARID1B is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol