H00057492-M02
antibody from Abnova Corporation
Targeting: ARID1B
6A3-5, BAF250b, DAN15, ELD/OSA1, KIAA1235, p250R
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057492-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057492-M02, RRID:AB_875464
- Product name
- ARID1B monoclonal antibody (M02), clone 2F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARID1B.
- Antigen sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDR
RPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGP
LQSSSSEGPQQNMWAARNDMPYPYQNR- Isotype
- IgG
- Antibody clone number
- 2F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dynamics of expression of ARID1A and ARID1B subunits in mouse embryos and in cells during the cell cycle.
Flores-Alcantar A, Gonzalez-Sandoval A, Escalante-Alcalde D, LomelĂ H
Cell and tissue research 2011 Jul;345(1):137-48
Cell and tissue research 2011 Jul;345(1):137-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ARID1B monoclonal antibody (M02), clone 2F2 Western Blot analysis of ARID1B expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol