HPA016511

ARID1B antibody from Sigma-Aldrich
6A3-5, BAF250b, DAN15, ELD/OSA1, KIAA1235, p250R
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016511
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016511, RRID:AB_1845008
Product name
Anti-ARID1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016511
Antibody type
Polyclonal
Antigen
AT-rich interactive domain-containing protein 1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISAN
NQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMS
SMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAV
MQAAANSAQSR
Storage
-20C
Provider Type Product Number
- No reagents -