HPA026481

DBT antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026481
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026481, RRID:AB_1847504
Product name
Anti-DBT antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026481
Antibody type
Polyclonal
Antigen
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQFPILNASVDENCQNITYKASHNIGIAMDTEQGL
IVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTT
DLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGA
Storage
-20C
Provider Type Product Number
- No reagents -