HPA007598

PHYH antibody from Atlas Antibodies
PAHX, PHYH1, RD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007598
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007598, RRID:AB_1855334
Product name
Anti-PHYH
Provider product page
Atlas Antibodies - HPA007598
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENK
ARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAI
SCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFG
AENSVNLKDIWMFRA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -