HPA007598

PHYH antibody from MilliporeSigma / Merck KGaA
PAHX, PHYH1, RD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007598
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007598, RRID:AB_1855334
Product name
Anti-PHYH antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007598
Antibody type
Polyclonal
Antigen
Phytanoyl-CoA dioxygenase, peroxisomal precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENK
ARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAI
SCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFG
AENSVNLKDIWMFRA
Storage
-20C
Provider Type Product Number
- No reagents -