HPA023783

CDC14A antibody from Sigma-Aldrich
cdc14, Cdc14A1, Cdc14A2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023783
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023783, RRID:AB_1846352
Product name
Anti-CDC14A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023783
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase CDC14A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINK
ILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEM
KNGITQGDKLRAL
Storage
-20C
Provider Type Product Number
- No reagents -