HPA001116

CEP128 antibody from Atlas Antibodies
C14orf145, C14orf61
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001116
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001116, RRID:AB_1078323
Product name
Anti-CEP128
Provider product page
Atlas Antibodies - HPA001116
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEMGSLQDRVIALETSTQVALDHLESVPEKLSLLE
DFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDD
TKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRF
LSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSS
QPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -