HPA001116

CEP128 antibody from Atlas Antibodies
C14orf145, C14orf61
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001116
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001116, RRID:AB_611925
Product name
Anti-CEP128
Provider product page
Atlas Antibodies - HPA001116
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEMGSLQDRVIALETSTQVALDHLESVPEKLSLLE
DFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDD
TKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRF
LSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSS
QPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -