HPA018498

CEP128 antibody from Sigma-Aldrich
C14orf145, C14orf61
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018498
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018498, RRID:AB_1845560
Product name
Anti-C14orf145 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018498
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf145 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEKSEAENHIRTLKAESLEEKNMAKIHRGQLEKLK
SQCDRLTEELTQNENENKKLKLKYQCLKDQLEERE
KHISIEEEHLRRMEEARLQLKDQLLCLETEQESIL
GVIGKEIDAACKTFSKDSVEKLKVFSSGPDIHYDP
Storage
-20C
Provider Type Product Number
- No reagents -