HPA000993

MPP5 antibody from Sigma-Aldrich
FLJ12615, PALS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000993
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000993, RRID:AB_1079407
Product name
Anti-MPP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000993
Antibody type
Polyclonal
Antigen
MAGUK p55 subfamily member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTG
IDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKH
IQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNA
ITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHK
EGQELTAL
Storage
-20C
Provider Type Product Number
- No reagents -