HPA000603

CRELD2 antibody from Sigma-Aldrich
MGC11256
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000603
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000603, RRID:AB_1078565
Product name
Anti-CRELD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000603
Antibody type
Polyclonal
Antigen
Cysteine-rich with EGF-like domain protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYG
PDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCH
MGYQGPLCTDCMDGYFSSLRNETHSICTACDESCK
TCSGLTNRDCGECEVG
Storage
-20C
Provider Type Product Number
- No reagents -