HPA007599

P4HA1 antibody from Atlas Antibodies
C-P4Halpha(I), P4HA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007599
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007599, RRID:AB_1854891
Product name
Anti-P4HA1
Provider product page
Atlas Antibodies - HPA007599
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQI
KKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRL
NTEWSELENLVLKDMSDGFISNLTIQRQYFPNDED
QVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSF
LTAEDC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -