HPA007599

P4HA1 antibody from Sigma-Aldrich
C-P4Halpha(I), P4HA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007599
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007599, RRID:AB_1854891
Product name
Anti-P4HA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007599
Antibody type
Polyclonal
Antigen
Prolyl 4-hydroxylase subunit alpha-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQI
KKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRL
NTEWSELENLVLKDMSDGFISNLTIQRQYFPNDED
QVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSF
LTAEDC
Storage
-20C
Provider Type Product Number
- No reagents -