Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA025716 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA025716, RRID:AB_2185128
- Product name
- Anti-SERAC1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIM
ESSHAARILANLDRETVQEKYQDGVYVLHPQYRTS
QPIKA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutations in the phospholipid remodeling gene SERAC1 impair mitochondrial function and intracellular cholesterol trafficking and cause dystonia and deafness
Wortmann S, Vaz F, Gardeitchik T, Vissers L, Renkema G, Schuurs-Hoeijmakers J, Kulik W, Lammens M, Christin C, Kluijtmans L, Rodenburg R, Nijtmans L, Grünewald A, Klein C, Gerhold J, Kozicz T, van Hasselt P, Harakalova M, Kloosterman W, Barić I, Pronicka E, Ucar S, Naess K, Singhal K, Krumina Z, Gilissen C, van Bokhoven H, Veltman J, Smeitink J, Lefeber D, Spelbrink J, Wevers R, Morava E, de Brouwer A
Nature Genetics 2012 June;44(7):797-802
Nature Genetics 2012 June;44(7):797-802
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gall bladder shows strong membranous and cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN