HPA007600

BBOX1 antibody from Atlas Antibodies
BBH, BBOX, G-BBH, gamma-BBH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007600
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007600, RRID:AB_1845284
Product name
Anti-BBOX1
Provider product page
Atlas Antibodies - HPA007600
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQ
TVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFV
DFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFN
NATRDTIFDVPVERVQPFYAALKEFVDLMNSKESK
LT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -