HPA007600

BBOX1 antibody from Sigma-Aldrich
BBH, BBOX, G-BBH, gamma-BBH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007600, RRID:AB_1845284
Product name
Anti-BBOX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007600
Antibody type
Polyclonal
Antigen
Gamma-butyrobetaine dioxygenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQ
TVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFV
DFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFN
NATRDTIFDVPVERVQPFYAALKEFVDLMNSKESK
LT
Storage
-20C
Provider Type Product Number
- No reagents -