Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502928 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Acetyl-CoA Acyltransferase 2 (ACAA2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACAA2 antibody: synthetic peptide directed towards the N terminal of human ACAA2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFA
AKAAL SAGKVSPETV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
The Islets of Langerhans in Relation to Diabetes.
Aboulaich N, Vainonen JP, Strålfors P, Vener AV
The Biochemical journal 2004 Oct 15;383(Pt 2):237-48
The Biochemical journal 2004 Oct 15;383(Pt 2):237-48
The Islets of Langerhans in Relation to Diabetes.
Rennie J, Fraser T
The Biochemical journal 1907;2(1-2):7-19
The Biochemical journal 1907;2(1-2):7-19
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting