HPA025736

ACAT2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025736, RRID:AB_1844487
Product name
Anti-ACAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025736
Antibody type
Polyclonal
Antigen
Acetyl-CoA acetyltransferase, cytosolic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLT
DGTGTVTPANASGINDGAAAVVLMKKSEADKRGLT
Storage
-20C
Provider Type Product Number
- No reagents -