HPA021400

CPS1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021400
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021400, RRID:AB_1847197
Product name
Anti-CPS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021400
Antibody type
Polyclonal
Antigen
Carbamoyl-phosphate synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLF
ATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIR
KLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDS
GIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQY
SA
Storage
-20C
Provider Type Product Number
- No reagents -