HPA007196

ALKBH5 antibody from Sigma-Aldrich
FLJ20308, OFOXD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007196
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007196, RRID:AB_1850461
Product name
Anti-ALKBH5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007196
Antibody type
Polyclonal
Antigen
Alkylated DNA repair protein alkB homolog 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAA
AAEPYPVSGAKRKYQEDSDPERSDYEEQQLQKEEE
ARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEK
GLYNEHTVD
Storage
-20C
Provider Type Product Number
- No reagents -