HPA008567

SLC22A2 antibody from Sigma-Aldrich
OCT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008567
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008567, RRID:AB_1854769
Product name
Anti-SLC22A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008567
Antibody type
Polyclonal
Antigen
Solute carrier family 22 member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQ
RLRLEEETGKKLNPSFLDLVRTPQIR
Storage
-20C
Provider Type Product Number
- No reagents -