PAB20588

KDM7A antibody from Abnova Corporation
JHDM1D, KIAA1718

Antibody data

Product number
PAB20588
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20588, RRID:AB_10963630
Product name
JHDM1D polyclonal antibody
Provider product page
Abnova Corporation - PAB20588
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant JHDM1D.
Antigen sequence
LETLKELREDGFQPQTYLVQGVKALHTALKLWMKK
ELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENG
KPVKSQGIPIVCPVSRSSNEA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.