HPA012114

KDM7A antibody from Sigma-Aldrich
JHDM1D, KIAA1718
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012114
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012114, RRID:AB_1852429
Product name
Anti-JHDM1D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012114
Antibody type
Polyclonal
Antigen
JmjC domain-containing histone demethylation protein 1D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LETLKELREDGFQPQTYLVQGVKALHTALKLWMKK
ELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENG
KPVKSQGIPIVCPVSRSSNEA
Storage
-20C
Provider Type Product Number
- No reagents -