HPA012114

KDM7A antibody from Atlas Antibodies
JHDM1D, KIAA1718
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012114
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012114, RRID:AB_1234647
Product name
Anti-KDM7A
Provider product page
Atlas Antibodies - HPA012114
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LETLKELREDGFQPQTYLVQGVKALHTALKLWMKK
ELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENG
KPVKSQGIPIVCPVSRSSNEA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -