SAB2101190

KDM7A antibody from MilliporeSigma / Merck KGaA
JHDM1D, KIAA1718
No application information provided.

Antibody data

Product number
SAB2101190
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-JHDM1D antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101190
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_085150.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQK
CIRKEGSSEISQRVQ
Storage
-20C